Last active
August 29, 2015 13:57
-
-
Save alexmasselot/9399527 to your computer and use it in GitHub Desktop.
pViz.js different track heights
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<html> | |
<head> | |
<title>pViz.js different track heights</title> | |
<link rel="stylesheet" href="//netdna.bootstrapcdn.com/bootstrap/3.1.1/css/bootstrap.min.css"> | |
<link rel="stylesheet" type="text/css" href="http://research-pub.gene.com/pviz/examples/deps/pviz-core.css"> | |
<script src="http://research-pub.gene.com/pviz/examples/deps/pviz-bundle.min.js"></script> | |
<style type="text/css" media="screen" class='example'> | |
g.feature rect.coverage_bar.psm_coverage { | |
fill: blue; | |
fill-opacity: 0.4; | |
} | |
g.feature rect.coverage_bar.psm_no_coverage { | |
fill: red; | |
fill-opacity: 0.4; | |
} | |
</style> | |
</head> | |
<body class="container"> | |
<div class="row"> | |
<h2>pViz with different track heights example</h2> | |
</div> | |
<!-- min-width is for http://bl.ocks.org/ iframe (doc width sometimes 0 at init time)--> | |
<div id="main" class="row" style="min-width:720px"></div> | |
<div class="row"> | |
<h4>Way more examples and demo apps with pViz <a href="http://research-pub.gene.com/pviz/examples/" target="_TOP_">here</a></h4> | |
</div> | |
<script class="example"> | |
var pviz = this.pviz; | |
var seq = 'MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNAS'; | |
var seqEntry = new pviz.SeqEntry({ | |
sequence : seq | |
}); | |
/** | |
* attach a track height ratio to the category (1 is the default) | |
*/ | |
pviz.FeatureDisplayer.trackHeightPerCategoryType.psms = 0.2; | |
pviz.FeatureDisplayer.trackHeightPerCategoryType.psms_coverage = 3; | |
pviz.FeatureDisplayer.setStrikeoutCategory('oups'); | |
new pviz.SeqEntryAnnotInteractiveView({ | |
model : seqEntry, | |
el : '#main' | |
}).render(); | |
pviz.FeatureDisplayer.setCustomHandler(['psm_coverage', 'psm_no_coverage'], { | |
appender : function(viewport, svgGroup, features, type) { | |
var sel = svgGroup.selectAll("g.feature.internal.data." + type).data(features).enter().append("g").attr("class", "feature internal data " + type) | |
sel.append("rect").attr('class', function(ft) { | |
return 'coverage_bar ' + ft.type | |
}) | |
return sel; | |
}, | |
positioner : function(viewport, d3selection) { | |
// d3selection.attr('transform', function(ft, i) { | |
// return 'translate(' + + ',' + viewport.scales.y(ft.displayTrack) + ')'; | |
// }); | |
var w1 = viewport.scales.x(10) - viewport.scales.x(9); | |
var hMax = viewport.scales.y(1) * pviz.FeatureDisplayer.heightFactor('psms_coverage'); | |
d3selection.selectAll("rect.coverage_bar.psm_coverage").attr('height', function(ft) { | |
return ft.coverage * hMax; | |
}) | |
d3selection.selectAll("rect.coverage_bar.psm_no_coverage").attr('height', hMax); | |
d3selection.selectAll("rect.coverage_bar").attr('x', function(ft) { | |
return viewport.scales.x(ft.start - 0.5); | |
}).attr('width', function(ft) { | |
return viewport.scales.x(ft.start + 0.5) - viewport.scales.x(ft.start - 0.5); | |
}); | |
return d3selection | |
} | |
}); | |
var fts = [[0, 30], [3, 15], [10, 16], [2, 8], [35, 50], [60, 69], [60, 65], [60, 62], [61, 62], [4, 15], [7, 15], [62, 69], [40, 50], [9, 15]]; | |
seqEntry.addFeatures(fts.map(function(ft) { | |
return { | |
//we could also use te categoryType property, for height purpose, but not grouping purpose | |
category : 'psms', | |
type : 'psm', | |
start : ft[0], | |
end : ft[1], | |
text : '' | |
} | |
})); | |
/* | |
* now we just compute the coverage by counting how many psms cover each amino acid | |
*/ | |
var coverage = [] | |
for ( i = 0; i < seqEntry.length(); i++) { | |
coverage[i] = 0; | |
} | |
var max = 0; | |
fts.forEach(function(ft) { | |
for ( i = ft[0]; i <= ft[1]; i++) { | |
coverage[i]++; | |
max = Math.max(coverage[i], max) | |
} | |
}); | |
/* | |
* and ad new features for that | |
*/ | |
seqEntry.addFeatures(coverage.map(function(c, i) { | |
return { | |
category : 'psms_coverage', | |
type : (c == 0) ? 'psm_no_coverage' : 'psm_coverage', | |
start : i, | |
end : i, | |
text : c, | |
coverage : c / max | |
} | |
})); | |
seqEntry.addFeatures({ | |
category : 'oups', | |
type : 'oups', | |
start : 10, | |
end : 40, | |
text : 'oups' | |
}); | |
</script> | |
</body> | |
</html> |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment