Last active
August 29, 2015 13:57
-
-
Save alexmasselot/9399600 to your computer and use it in GitHub Desktop.
pViz.js one liner with selected categories
This file contains bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
<html> | |
<head> | |
<title>pViz.js one liner with selected categories</title> | |
<link rel="stylesheet" href="//netdna.bootstrapcdn.com/bootstrap/3.1.1/css/bootstrap.min.css"> | |
<link rel="stylesheet" type="text/css" href="http://research-pub.gene.com/pviz/examples/deps/pviz-core.css"> | |
<script src="http://research-pub.gene.com/pviz/examples/deps/pviz-bundle.min.js"></script> | |
</head> | |
<body class="container"> | |
<div class="row"> | |
<h2>pViz, a one-line example with selected categories</h2> | |
</div> | |
<div class="row"> | |
<div class="span6"> | |
<table class="table table-bordered"> | |
<thead> | |
<tr> | |
<th>id</th> | |
<th>psms</th> | |
</tr> | |
</thead> | |
<tbody> | |
<td> HER2 head </td> | |
<td id="one-liner"></td> | |
</tbody> | |
</table> | |
</div> | |
</div> | |
<div class="row"> | |
<h3>Comments</h3> | |
We define a SeqEntry object, map features on it and display it as a simple one-liner image. | |
<br/> | |
More complex than the <a href="example-one-liner.html">whole features at once</a> one-liner, we can select a groups of features and display each of them on a line. | |
<br/> | |
We propose here a dispay of fictitious peptide/spectrum matches (PSM) coverage from two experiments (the | |
<code> | |
group | |
</code> | |
attibute is the experimental source) | |
</div> | |
<div class="row"> | |
<h4>Way more examples and demo apps with pViz <a href="http://research-pub.gene.com/pviz/examples/" target="_TOP_">here</a></h4> | |
</div> | |
<script class="example"> | |
//namespace handling pViz classes | |
var pviz = this.pviz; | |
/* | |
* Define the model, a sequence entry with an explicit sequence | |
* For this example, we don't actually need the sequence itself. | |
* Whatever string with the correct length is OK (ok, it's ugly, but it can be useful in certain cases) | |
*/ | |
var seqEntry = new pviz.SeqEntry({ | |
sequence : 'MELAALCRWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA' | |
}); | |
new pviz.OneLiner({ | |
model : seqEntry, | |
el : '#one-liner', | |
categories:['exp-A', 'exp-B'] | |
}).render(); | |
/* | |
* Features are added explicitely. | |
* There is only on group of features here (secondary_structure). There can be more that would be merged or we could keep only one group with the filer:'xxx' option | |
* | |
* In real application, these features would be read from DASReader, a PeffReader or whatever ajax call you find convenient (the view is rendered when model changes) | |
*/ | |
seqEntry.addFeatures([{ | |
category : 'exp-A', | |
type : 'psm', | |
start : 24, | |
end : 26 | |
},{ | |
category : 'exp-B', | |
type : 'psm', | |
start : 24, | |
end : 26 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 38, | |
end : 49 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 53, | |
end : 57 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 59, | |
end : 63 | |
}, { | |
category : 'exp-B', | |
type : 'psm', | |
start : 59, | |
end : 63 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 71, | |
end : 73 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 78, | |
end : 81 | |
}, { | |
category : 'exp-B', | |
type : 'psm', | |
start : 78, | |
end : 87 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 83, | |
end : 87 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 91, | |
end : 94 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 108, | |
end : 110 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 111, | |
end : 116 | |
}, { | |
category : 'exp-B', | |
type : 'psm', | |
start : 111, | |
end : 124 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 129, | |
end : 131 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 138, | |
end : 140 | |
}, { | |
category : 'exp-A', | |
type : 'psm', | |
start : 150, | |
end : 155 | |
}]); | |
</script> | |
</body> | |
</html> |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment